PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02912.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 244aa    MW: 27810 Da    PI: 5.0565
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02912.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM82.87e-261081173
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkr 73
                             lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePwdLp k+k + kewyfFs rd+ky+tg+ 
  Sme2.5_02912.1_g00001.1 10 LPPGFRFHPTDEELITYYLVNKINDGNFTG-RAIADVDLNKSEPWDLPGKAKMGGKEWYFFSLRDRKYPTGQD 81
                             79*************************999.89***************999999****************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-29584IPR003441NAC domain
PROSITE profilePS5100521.88310173IPR003441NAC domain
PfamPF023656.6E-121183IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEEVKEETQL PPGFRFHPTD EELITYYLVN KINDGNFTGR AIADVDLNKS EPWDLPGKAK  60
MGGKEWYFFS LRDRKYPTGQ DEWAVCRIFQ KSVGLKKYPT NQYSRVNPYS LNNIQNASIS  120
PQMMMQLPHD RQGFQFAMGR NSNYMNSHGD IQDFNNRVIF QSGSSNLINN FPNIQPQMSY  180
NIGGGDVVAS SQPILRQQEV ATSMMANCAI TSYGGEMNNN ANNMNSGVME MDHCADLDNY  240
WTTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-23279784Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0093573e-70AP009357.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0025I17, complete sequence.
GenBankAP0094833e-70AP009483.1 Solanum lycopersicum DNA, chromosome 8, clone: C08SLm0116H03, complete sequence.
GenBankAP0107843e-70AP010784.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0021H05, complete sequence.
GenBankHG9754473e-70HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755203e-70HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006357022.23e-72PREDICTED: NAC domain-containing protein 100-like
TrEMBLK4CI913e-54K4CI91_SOLLC; Uncharacterized protein
STRINGSolyc08g006020.2.18e-54(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.25e-45NAC domain containing protein 38